Common Phylogenetic Origin of Protamine-like (PL) Proteins and Histone H1: Evidence from Bivalve PL Genes
نویسندگان
چکیده
منابع مشابه
Common phylogenetic origin of protamine-like (PL) proteins and histone H1: Evidence from bivalve PL genes.
Sperm nuclear basic proteins (SNBPs) can be grouped into three main categories: histone (H) type, protamine (P) type, and protamine-like (PL) type. Protamine-like SNBPs represent the most structurally heterogeneous group, consisting of basic proteins which are rich in both lysine and arginine amino acids. The PL proteins replace most of the histones during spermiogenesis but to a lesser extent ...
متن کاملAn unusual cysteine-containing histone H1-like protein and two protamine-like proteins are the major nuclear proteins of the sperm of the bivalve mollusc Macoma nasuta.
The sperm-specific protamine-like (PL) components PL-I, PL-II, and PL-III from the sperm of the bent-nose clam Macoma nasuta have been isolated and characterized for the first time. These proteins coexist in the sperm nuclei with a small percentage of a full histone complement. All of them have a very similar amino acid composition, following what seems to be the general composition prototype f...
متن کاملPrimary, secondary, and tertiary structure of the core of a histone H1-like protein from the sperm of Mytilus.
We have analyzed the structure of the trypsin-resistant core of the protein PL-II* of the sperm from Mytilus californianus. The peptide has a molecular mass of 8436 Da and its primary sequence is ATGGAKKP STLSMIVAAIQAMKNRKGSSVQAIRKYILANNKG INTSRLGSAMKLAFAKGLKSGVLVRPKTSAGA SGATGSFRVG. This sequence bears an enormous homology and fulfills the constraints of the consensus sequence of the trypsin-r...
متن کاملPL-Geodesics on PL-Continuous Partial Meshes
Geometric characteristics of 2-manifolds embedded in R space have been analyzed from the point of view of differential geometry and topology. In the past, results relevant to these areas have been found for C curves and surfaces. However, current scientific, industrial, entertainment and medical applications, and availability of more powerful point sampling systems, press for characterization o...
متن کاملThe sperm proteins from amphioxus mirror its basal position among chordates and redefine the origin of vertebrate protamines.
The sperm nuclear basic proteins (SNBPs) that participate in chromatin condensation in spermatozoa belong to 3 groups: histone (H), protamine-like (PL), and protamine (P) type. They share a common origin with histone H1 resulting from the segregation of PL components, corresponding to different regions of an H1 precursor molecule (N-terminal, winged-helix, C-terminal domains), becoming independ...
متن کاملذخیره در منابع من
با ذخیره ی این منبع در منابع من، دسترسی به آن را برای استفاده های بعدی آسان تر کنید
ژورنال
عنوان ژورنال: Molecular Biology and Evolution
سال: 2006
ISSN: 1537-1719,0737-4038
DOI: 10.1093/molbev/msk021